SCOPe 2.06: Domain d5lsda_: 5lsd A:

Lineage for d5lsda_ (5lsd A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.3: Neurotrophin [57520] (5 proteins)
   automatically mapped to Pfam PF00243

6. Protein beta-Nerve growth factor [57525] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57527] (6 PDB entries)
   Uniprot P01138

8. Domain d5lsda_: 5lsd A: [336500]
   automated match to d1wwww_

Details for d5lsda_

PDB Entry: 5lsd

PDB Description: recombinant mouse nerve growth factor

PDB Compounds: (A:) Beta-nerve growth factor

SCOPe Domain Sequences for d5lsda_:

Sequence; same for both SEQRES and ATOM records:

>d5lsda_ g.17.1.3 (A:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
ssthpvfhmgefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcra
snpvesgcrgidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr

Timeline for d5lsda_:

• d5lsda_ is new in SCOPe 2.06-stable
  
• d5lsda_ appears in SCOPe 2.07
  
• d5lsda_ appears in the current release, SCOPe 2.08