| Class g: Small proteins [56992] (94 folds) |
| Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) ![]() |
| Family g.17.1.3: Neurotrophin [57520] (5 proteins) automatically mapped to Pfam PF00243 |
| Protein beta-Nerve growth factor [57525] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57527] (6 PDB entries) Uniprot P01138 |
| Domain d5lsda_: 5lsd A: [336500] automated match to d1wwww_ |
PDB Entry: 5lsd (more details)
SCOPe Domain Sequences for d5lsda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lsda_ g.17.1.3 (A:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
ssthpvfhmgefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcra
snpvesgcrgidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr
Timeline for d5lsda_: