Lineage for d5o7ab2 (5o7a B:246-437)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565857Protein automated matches [227071] (7 species)
    not a true protein
  7. 2565863Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries)
  8. 2566322Domain d5o7ab2: 5o7a B:246-437 [336494]
    Other proteins in same PDB: d5o7aa1, d5o7ab1, d5o7ac1, d5o7ad1, d5o7ae_, d5o7af1, d5o7af2
    automated match to d3rycd2
    complexed with 9n5, acp, gdp, gtp, mg

Details for d5o7ab2

PDB Entry: 5o7a (more details), 2.5 Å

PDB Description: quinolin-6-yloxyacetamides are microtubule destabilizing agents that bind to the colchicine site of tubulin
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5o7ab2:

Sequence, based on SEQRES records: (download)

>d5o7ab2 d.79.2.1 (B:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqd

Sequence, based on observed residues (ATOM records): (download)

>d5o7ab2 d.79.2.1 (B:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfaplqyraltvpeltqqmfdsknmmaacdprhgr
yltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfig
nstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqd

SCOPe Domain Coordinates for d5o7ab2:

Click to download the PDB-style file with coordinates for d5o7ab2.
(The format of our PDB-style files is described here.)

Timeline for d5o7ab2: