Lineage for d5o7ab1 (5o7a B:1-245)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2471422Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2471549Protein automated matches [226837] (10 species)
    not a true protein
  7. 2471590Species Cow (Bos taurus) [TaxId:9913] [226564] (128 PDB entries)
  8. 2472035Domain d5o7ab1: 5o7a B:1-245 [336493]
    Other proteins in same PDB: d5o7aa2, d5o7ab2, d5o7ac2, d5o7ad2, d5o7ae_, d5o7af1, d5o7af2
    automated match to d4drxb1
    complexed with 9n5, acp, gdp, gtp, mg

Details for d5o7ab1

PDB Entry: 5o7a (more details), 2.5 Å

PDB Description: quinolin-6-yloxyacetamides are microtubule destabilizing agents that bind to the colchicine site of tubulin
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5o7ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o7ab1 c.32.1.1 (B:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d5o7ab1:

Click to download the PDB-style file with coordinates for d5o7ab1.
(The format of our PDB-style files is described here.)

Timeline for d5o7ab1: