Lineage for d5o7ae_ (5o7a E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733915Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2733916Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2733917Protein Stathmin 4 [101496] (3 species)
  7. 2733934Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)
  8. 2734078Domain d5o7ae_: 5o7a E: [336481]
    Other proteins in same PDB: d5o7aa1, d5o7aa2, d5o7ab1, d5o7ab2, d5o7ac1, d5o7ac2, d5o7ad1, d5o7ad2, d5o7af1, d5o7af2
    automated match to d4i55e_
    complexed with 9n5, acp, gdp, gtp, mg

Details for d5o7ae_

PDB Entry: 5o7a (more details), 2.5 Å

PDB Description: quinolin-6-yloxyacetamides are microtubule destabilizing agents that bind to the colchicine site of tubulin
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5o7ae_:

Sequence, based on SEQRES records: (download)

>d5o7ae_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d5o7ae_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsleeiqkkleaaeerrkyqeaellkhlaekreherevi
qkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelke

SCOPe Domain Coordinates for d5o7ae_:

Click to download the PDB-style file with coordinates for d5o7ae_.
(The format of our PDB-style files is described here.)

Timeline for d5o7ae_: