SCOPe 2.07: Domain d5lpub_: 5lpu B:

Lineage for d5lpub_ (5lpu B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.65: Annexin [47873] (1 superfamily)
   5 helices; folded leaf, closed

4. Superfamily a.65.1: Annexin [47874] (2 families)
   duplication: consists of four domains of the same fold

5. Family a.65.1.1: Annexin [47875] (10 proteins)

6. Protein automated matches [190368] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188886] (9 PDB entries)

8. Domain d5lpub_: 5lpu B: [336477]
   Other proteins in same PDB: d5lpuc_, d5lpud1, d5lpud2
   automated match to d1w7ba_
   complexed with ca, gol

Details for d5lpub_

PDB Entry: 5lpu, 2.1 Å

PDB Description: crystal structure of annexin a2 complexed with s100a4

PDB Compounds: (B:) annexin a2

SCOPe Domain Sequences for d5lpub_:

Sequence; same for both SEQRES and ATOM records:

>d5lpub_ a.65.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stvheilcklslegdhstppsaygsvkaytnfdaerdalnietaiktkgvdevtivnilt
nrsneqrqdiafayqrrtkkelasalksalsghletvilgllktpaqydaselkasmkgl
gtdedslieiicsrtnqelqeinrvykemyktdlekdiisdtsgdfrklmvalakgrrae
dgsvidyelidqdardlydagvkrkgtdvpkwisimtersvphlqkvfdryksyspydml
esirkevkgdlenaflnlvqciqnkplyfadrlydsmkgkgtrdkvlirimvsrsevdml
kirsefkrkygkslyyyiqqdtkgdyqkallylcggdd

Timeline for d5lpub_:

• d5lpub_ first appeared in SCOPe 2.06
  
• d5lpub_ appears in the current release, SCOPe 2.08