Lineage for d5lpub_ (5lpu B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717085Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2717086Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2717087Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2717186Protein automated matches [190368] (3 species)
    not a true protein
  7. 2717189Species Human (Homo sapiens) [TaxId:9606] [188886] (10 PDB entries)
  8. 2717194Domain d5lpub_: 5lpu B: [336477]
    Other proteins in same PDB: d5lpuc_, d5lpud1, d5lpud2
    automated match to d1w7ba_
    complexed with ca, gol

Details for d5lpub_

PDB Entry: 5lpu (more details), 2.1 Å

PDB Description: crystal structure of annexin a2 complexed with s100a4
PDB Compounds: (B:) annexin a2

SCOPe Domain Sequences for d5lpub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lpub_ a.65.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stvheilcklslegdhstppsaygsvkaytnfdaerdalnietaiktkgvdevtivnilt
nrsneqrqdiafayqrrtkkelasalksalsghletvilgllktpaqydaselkasmkgl
gtdedslieiicsrtnqelqeinrvykemyktdlekdiisdtsgdfrklmvalakgrrae
dgsvidyelidqdardlydagvkrkgtdvpkwisimtersvphlqkvfdryksyspydml
esirkevkgdlenaflnlvqciqnkplyfadrlydsmkgkgtrdkvlirimvsrsevdml
kirsefkrkygkslyyyiqqdtkgdyqkallylcggdd

SCOPe Domain Coordinates for d5lpub_:

Click to download the PDB-style file with coordinates for d5lpub_.
(The format of our PDB-style files is described here.)

Timeline for d5lpub_: