SCOPe 2.08: Domain d5kkwa1: 5kkw A:13-248

Lineage for d5kkwa1 (5kkw A:13-248)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Pelagibacter ubique [TaxId:335992] [314766] (2 PDB entries)

8. Domain d5kkwa1: 5kkw A:13-248 [336473]
   Other proteins in same PDB: d5kkwa2
   automated match to d3kbra_
   complexed with kh2, so4

Details for d5kkwa1

PDB Entry: 5kkw, 1.88 Å

PDB Description: crystal structure of sar11_1068 bound to a sulfobetaine (3-(1- methylpiperidinium-1-yl)propane-1-sulfonate)

PDB Compounds: (A:) Cyclohexadienyl dehydratase

SCOPe Domain Sequences for d5kkwa1:

Sequence; same for both SEQRES and ATOM records:

>d5kkwa1 c.94.1.0 (A:13-248) automated matches {Pelagibacter ubique [TaxId: 335992]}
eskldqilssgelkvgttgdwdpmamkdpatnkykgfdidvmqelakdmgvkitfvptew
ktivsgitagrydistsvtktpkraevagftdsyykygtvplvlkknlkkystwkslnnk
dvtiattlgtsqeekakeffplsklqsvespardfqevlagradgnitssteanklvvky
pqlaivpdgeknpaflammvskndqvwndyvnewikskkssgffnkllakynlksl

Timeline for d5kkwa1:

• d5kkwa1 first appeared in SCOPe 2.06
  
• d5kkwa1 appears in SCOPe 2.07