![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) ![]() automatically mapped to Pfam PF00016 |
![]() | Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins) N-terminal domain is alpha+beta |
![]() | Protein automated matches [226984] (9 species) not a true protein |
![]() | Species Rhodopseudomonas palustris [TaxId:258594] [257017] (3 PDB entries) |
![]() | Domain d5koze2: 5koz E:139-455 [336471] Other proteins in same PDB: d5koza1, d5kozb1, d5kozc1, d5kozd1, d5koze1, d5kozf1, d5kozg1, d5kozh1, d5kozi1, d5kozj1, d5kozk1, d5kozl1 automated match to d4lf2a2 complexed with cap, co3, mg; mutant |
PDB Entry: 5koz (more details), 2.3 Å
SCOPe Domain Sequences for d5koze2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5koze2 c.1.14.1 (E:139-455) automated matches {Rhodopseudomonas palustris [TaxId: 258594]} gpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanacydfwlggdficndepqg nqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyemlargefiletfadnadh iaflvdgyvagpaavttarrafpkqylhyhraghgavtspqskrgytafvlskmarlqga sgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlgmnpttpiisggmnalrmp gffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqgadpvefakdhrefaraf esfpqdadklypnwrak
Timeline for d5koze2: