![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
![]() | Protein automated matches [226983] (18 species) not a true protein |
![]() | Species Rhodopseudomonas palustris [TaxId:258594] [257015] (3 PDB entries) |
![]() | Domain d5koze1: 5koz E:1-138 [336470] Other proteins in same PDB: d5koza2, d5kozb2, d5kozc2, d5kozd2, d5koze2, d5kozf2, d5kozg2, d5kozh2, d5kozi2, d5kozj2, d5kozk2, d5kozl2 automated match to d4lf2a1 complexed with cap, co3, mg; mutant |
PDB Entry: 5koz (more details), 2.3 Å
SCOPe Domain Sequences for d5koze1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5koze1 d.58.9.0 (E:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 258594]} mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve yakmydfyvppaylklfd
Timeline for d5koze1: