Lineage for d5lq0a_ (5lq0 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330207Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2330208Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2330209Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2330308Protein automated matches [190368] (3 species)
    not a true protein
  7. 2330311Species Human (Homo sapiens) [TaxId:9606] [188886] (9 PDB entries)
  8. 2330320Domain d5lq0a_: 5lq0 A: [336469]
    automated match to d1w7ba_
    complexed with ca

Details for d5lq0a_

PDB Entry: 5lq0 (more details), 2.9 Å

PDB Description: crystal structure of tyr24 phosphorylated annexin a2 at 2.9 a resolution
PDB Compounds: (A:) annexin a2

SCOPe Domain Sequences for d5lq0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lq0a_ a.65.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aygsvkaytnfdaerdalnietaiktkgvdevtivniltnrsneqrqdiafayqrrtkke
lasalksalsghletvilgllktpaqydaselkasmkglgtdedslieiicsrtnqelqe
inrvykemyktdlekdiisdtsgdfrklmvalakgrraedgsvidyelidqdardlydag
vkrkgtdvpkwisimtersvphlqkvfdryksyspydmlesirkevkgdlenaflnlvqc
iqnkplyfadrlydsmkgkgtrdkvlirimvsrsevdmlkirsefkrkygkslyyyiqqd
tkgdyqkallylcggdd

SCOPe Domain Coordinates for d5lq0a_:

Click to download the PDB-style file with coordinates for d5lq0a_.
(The format of our PDB-style files is described here.)

Timeline for d5lq0a_: