Lineage for d5kozi1 (5koz I:1-138)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195894Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2196090Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2196091Protein automated matches [226983] (18 species)
    not a true protein
  7. 2196291Species Rhodopseudomonas palustris [TaxId:258594] [257015] (3 PDB entries)
  8. 2196305Domain d5kozi1: 5koz I:1-138 [336465]
    Other proteins in same PDB: d5koza2, d5kozb2, d5kozc2, d5kozd2, d5koze2, d5kozf2, d5kozg2, d5kozh2, d5kozi2, d5kozj2, d5kozk2, d5kozl2
    automated match to d4lf2a1
    complexed with cap, co3, mg; mutant

Details for d5kozi1

PDB Entry: 5koz (more details), 2.3 Å

PDB Description: structure function studies of r. palustris rubisco (k192c mutant; cabp-bound)
PDB Compounds: (I:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5kozi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kozi1 d.58.9.0 (I:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

SCOPe Domain Coordinates for d5kozi1:

Click to download the PDB-style file with coordinates for d5kozi1.
(The format of our PDB-style files is described here.)

Timeline for d5kozi1: