SCOPe 2.06: Domain d5lpxa_: 5lpx A:

Lineage for d5lpxa_ (5lpx A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.65: Annexin [47873] (1 superfamily)
   5 helices; folded leaf, closed

4. Superfamily a.65.1: Annexin [47874] (2 families)
   duplication: consists of four domains of the same fold

5. Family a.65.1.1: Annexin [47875] (10 proteins)

6. Protein automated matches [190368] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188886] (6 PDB entries)

8. Domain d5lpxa_: 5lpx A: [336463]
   automated match to d1w7ba_
   complexed with ca, gol; mutant

Details for d5lpxa_

PDB Entry: 5lpx, 1.9 Å

PDB Description: crystal structure of pkc phosphorylation-mimicking mutant (s26e) annexin a2

PDB Compounds: (A:) annexin a2

SCOPe Domain Sequences for d5lpxa_:

Sequence; same for both SEQRES and ATOM records:

>d5lpxa_ a.65.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aytnfdaerdalnietaiktkgvdevtivniltnrsneqrqdiafayqrrtkkelasalk
salsghletvilgllktpaqydaselkasmkglgtdedslieiicsrtnqelqeinrvyk
emyktdlekdiisdtsgdfrklmvalakgrraedgsvidyelidqdardlydagvkrkgt
dvpkwisimtersvphlqkvfdryksyspydmlesirkevkgdlenaflnlvqciqnkpl
yfadrlydsmkgkgtrdkvlirimvsrsevdmlkirsefkrkygkslyyyiqqdtkgdyq
kallylcggdd

Timeline for d5lpxa_:

• d5lpxa_ is new in SCOPe 2.06-stable
  
• d5lpxa_ appears in SCOPe 2.07
  
• d5lpxa_ appears in the current release, SCOPe 2.08