Lineage for d5lhta2 (5lht A:211-284)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2193923Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2194218Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2194219Protein automated matches [190753] (16 species)
    not a true protein
  7. 2194341Species Mycobacterium tuberculosis [TaxId:83332] [335658] (3 PDB entries)
  8. 2194343Domain d5lhta2: 5lht A:211-284 [336461]
    Other proteins in same PDB: d5lhta1
    automated match to d1nh8a2
    complexed with gol, so4, tih

Details for d5lhta2

PDB Entry: 5lht (more details), 2.06 Å

PDB Description: atp phosphoribosyltransferase from mycobacterium tuberculosis in complex with the allosteric activator 3-(2-thienyl)-l-alanine
PDB Compounds: (A:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d5lhta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lhta2 d.58.5.0 (A:211-284) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qylmldydcprsalkkataitpglesptiapladpdwvairalvprrdvngimdelaaig
akailasdirfcrf

SCOPe Domain Coordinates for d5lhta2:

Click to download the PDB-style file with coordinates for d5lhta2.
(The format of our PDB-style files is described here.)

Timeline for d5lhta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5lhta1