SCOPe 2.08: Domain d5lhta2: 5lht A:211-284

Lineage for d5lhta2 (5lht A:211-284)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (21 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [335658] (3 PDB entries)

8. Domain d5lhta2: 5lht A:211-284 [336461]
   Other proteins in same PDB: d5lhta1
   automated match to d1nh8a2
   complexed with gol, so4, tih

Details for d5lhta2

PDB Entry: 5lht, 2.06 Å

PDB Description: atp phosphoribosyltransferase from mycobacterium tuberculosis in complex with the allosteric activator 3-(2-thienyl)-l-alanine

PDB Compounds: (A:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d5lhta2:

Sequence; same for both SEQRES and ATOM records:

>d5lhta2 d.58.5.0 (A:211-284) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qylmldydcprsalkkataitpglesptiapladpdwvairalvprrdvngimdelaaig
akailasdirfcrf

Timeline for d5lhta2:

• d5lhta2 first appeared in SCOPe 2.06
  
• d5lhta2 appears in SCOPe 2.07