| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
| Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
| Protein automated matches [190753] (21 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:83332] [335658] (3 PDB entries) |
| Domain d5lhta2: 5lht A:211-284 [336461] Other proteins in same PDB: d5lhta1 automated match to d1nh8a2 complexed with gol, so4, tih |
PDB Entry: 5lht (more details), 2.06 Å
SCOPe Domain Sequences for d5lhta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lhta2 d.58.5.0 (A:211-284) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qylmldydcprsalkkataitpglesptiapladpdwvairalvprrdvngimdelaaig
akailasdirfcrf
Timeline for d5lhta2: