SCOPe 2.08: Domain d5lhta1: 5lht A:1-210

Lineage for d5lhta1 (5lht A:1-210)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [335655] (5 PDB entries)

8. Domain d5lhta1: 5lht A:1-210 [336459]
   Other proteins in same PDB: d5lhta2
   automated match to d1nh8a1
   complexed with gol, so4, tih

Details for d5lhta1

PDB Entry: 5lht, 2.06 Å

PDB Description: atp phosphoribosyltransferase from mycobacterium tuberculosis in complex with the allosteric activator 3-(2-thienyl)-l-alanine

PDB Compounds: (A:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d5lhta1:

Sequence; same for both SEQRES and ATOM records:

>d5lhta1 c.94.1.1 (A:1-210) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mlrvavpnkgalsepateilaeagyrrrtdskdltvidpvnnveffflrpkdiaiyvgsg
eldfgitgrdlvcdsgaqvrerlalgfgsssfryaapagrnwttadlagmriataypnlv
rkdlatkgieatvirldgaveisvqlgvadaiadvvgsgrtlsqhdlvafgeplcdseav
lieragtdgqdqteardqlvarvqgvvfgq

Timeline for d5lhta1:

• d5lhta1 first appeared in SCOPe 2.06
  
• d5lhta1 appears in SCOPe 2.07