| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d5gksb2: 5gks B:109-209 [336456] Other proteins in same PDB: d5gksa1, d5gksa2, d5gksb1, d5gksc1, d5gksc2, d5gksd1 automated match to d2fb4l2 complexed with po4 |
PDB Entry: 5gks (more details), 2.05 Å
SCOPe Domain Sequences for d5gksb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gksb2 b.1.1.2 (B:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap
Timeline for d5gksb2: