SCOPe 2.08: Domain d5gksb2: 5gks B:109-209

Lineage for d5gksb2 (5gks B:109-209)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5gksb2: 5gks B:109-209 [336456]
   Other proteins in same PDB: d5gksa1, d5gksa2, d5gksb1, d5gksc1, d5gksc2, d5gksd1
   automated match to d2fb4l2
   complexed with po4

Details for d5gksb2

PDB Entry: 5gks, 2.05 Å

PDB Description: crystal structure of sle patient-derived anti-dna antibody

PDB Compounds: (B:) lambda, Fab (light chain)

SCOPe Domain Sequences for d5gksb2:

Sequence; same for both SEQRES and ATOM records:

>d5gksb2 b.1.1.2 (B:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

Timeline for d5gksb2:

• d5gksb2 first appeared in SCOPe 2.06
  
• d5gksb2 appears in SCOPe 2.07