SCOPe 2.08: Domain d5gksb1: 5gks B:2-108

Lineage for d5gksb1 (5gks B:2-108)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (24 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
Domain d5gksb1: 5gks B:2-108 [336455]
Other proteins in same PDB: d5gksa1, d5gksa2, d5gksb2, d5gksc1, d5gksc2, d5gksd2
automated match to d2mcg11
complexed with po4

Details for d5gksb1

PDB Entry: 5gks (more details), 2.05 Å

PDB Description: crystal structure of sle patient-derived anti-dna antibody

PDB Compounds: (B:) lambda, Fab (light chain)

SCOPe Domain Sequences for d5gksb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gksb1 b.1.1.1 (B:2-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqprsvsgspgqsvtisctgtssdvggynyvswyqqhpgkapkvmiydvskrpsgvp
drfsgsksgntasltisglqaedeadyyccsyagsytyvfgtgtkvtvlg

SCOPe Domain Coordinates for d5gksb1:

Click to download the PDB-style file with coordinates for d5gksb1.
(The format of our PDB-style files is described here.)

Timeline for d5gksb1: