Lineage for d5gk6a_ (5gk6 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2420459Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2421325Family c.1.10.2: Class II FBP aldolase [51591] (3 protein domains)
    metal-dependent
    automatically mapped to Pfam PF01116
  6. 2421326Protein Fructose-bisphosphate aldolase (FBP aldolase) [51592] (3 species)
  7. 2421334Species Escherichia coli [TaxId:83333] [336437] (8 PDB entries)
  8. 2421339Domain d5gk6a_: 5gk6 A: [336453]
    automated match to d1gyna_
    complexed with cit, peg, zn

Details for d5gk6a_

PDB Entry: 5gk6 (more details), 1.8 Å

PDB Description: structure of e.coli fructose 1,6-bisphosphate aldolase, citrate bound form
PDB Compounds: (A:) Fructose-bisphosphate aldolase class 2

SCOPe Domain Sequences for d5gk6a_:

Sequence, based on SEQRES records: (download)

>d5gk6a_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Escherichia coli [TaxId: 83333]}
skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctgg
eedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpti
lrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvl
nyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl

Sequence, based on observed residues (ATOM records): (download)

>d5gk6a_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Escherichia coli [TaxId: 83333]}
skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctly
tqpedvdyaytelskisprftiaasfgnvvltptilrdsqeyvskkhnlphnslnfvfhg
gsgstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqgqlgnpkgedqpnk
kyydprvwlragqtsmiarlekafqelnaidvl

SCOPe Domain Coordinates for d5gk6a_:

Click to download the PDB-style file with coordinates for d5gk6a_.
(The format of our PDB-style files is described here.)

Timeline for d5gk6a_: