Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) |
Protein Retroviral integrase, catalytic domain [53108] (3 species) |
Species Rous sarcoma virus RSV [TaxId:11886] [53109] (23 PDB entries) |
Domain d1c1ab2: 1c1a B:55-216 [33645] Other proteins in same PDB: d1c1aa1, d1c1ab1 |
PDB Entry: 1c1a (more details), 3.1 Å
SCOPe Domain Sequences for d1c1ab2:
Sequence, based on SEQRES records: (download)
>d1c1ab2 c.55.3.2 (B:55-216) Retroviral integrase, catalytic domain {Rous sarcoma virus RSV [TaxId: 11886]} lgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiavlgr pkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdrirvlaegd gfmkriptskqgellakamyalnhkergentktpiqkhwrpt
>d1c1ab2 c.55.3.2 (B:55-216) Retroviral integrase, catalytic domain {Rous sarcoma virus RSV [TaxId: 11886]} lgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiavlgr pkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdrirvlaegd gfmkriptskqgellakamyalnhkertpiqkhwrpt
Timeline for d1c1ab2: