Lineage for d1c1aa2 (1c1a A:52-216)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71788Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 72015Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 72110Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein)
  6. 72111Protein Retroviral integrase, catalytic domain [53108] (3 species)
  7. 72141Species Rous sarcoma virus (RSV, avian sarcoma virus) [53109] (21 PDB entries)
  8. 72165Domain d1c1aa2: 1c1a A:52-216 [33644]
    Other proteins in same PDB: d1c1aa1, d1c1ab1

Details for d1c1aa2

PDB Entry: 1c1a (more details), 3.1 Å

PDB Description: crystal structure of rsv two-domain integrase

SCOP Domain Sequences for d1c1aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1aa2 c.55.3.2 (A:52-216) Retroviral integrase, catalytic domain {Rous sarcoma virus (RSV, avian sarcoma virus)}
prglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiav
lgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdrirvla
egdgfmkriptskqgellakamyalnhkergentktpiqkhwrpt

SCOP Domain Coordinates for d1c1aa2:

Click to download the PDB-style file with coordinates for d1c1aa2.
(The format of our PDB-style files is described here.)

Timeline for d1c1aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c1aa1