Lineage for d5i4qc2 (5i4q C:298-394)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2386873Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2386874Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2386875Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)
  6. 2386978Protein automated matches [336429] (1 species)
    not a true protein
  7. 2386979Species Escherichia coli [TaxId:469008] [336430] (1 PDB entry)
  8. 2386980Domain d5i4qc2: 5i4q C:298-394 [336431]
    Other proteins in same PDB: d5i4qc1
    automated match to d1d8ta2
    complexed with cl, so4

Details for d5i4qc2

PDB Entry: 5i4q (more details), 2.35 Å

PDB Description: contact-dependent inhibition system from escherichia coli nc101 - ternary cdia/cdii/ef-tu complex (domains 2 and 3)
PDB Compounds: (C:) elongation factor tu

SCOPe Domain Sequences for d5i4qc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i4qc2 b.44.1.1 (C:298-394) automated matches {Escherichia coli [TaxId: 469008]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvlg

SCOPe Domain Coordinates for d5i4qc2:

Click to download the PDB-style file with coordinates for d5i4qc2.
(The format of our PDB-style files is described here.)

Timeline for d5i4qc2: