| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (130 species) not a true protein |
| Species Aquifex aeolicus [TaxId:224324] [188217] (15 PDB entries) |
| Domain d5xb2b_: 5xb2 B: [336410] automated match to d4s35b_ complexed with adp, f, mg, tmp |
PDB Entry: 5xb2 (more details), 2.16 Å
SCOPe Domain Sequences for d5xb2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xb2b_ c.37.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 224324]}
mliafegidgsgkttqakklyeylkqkgyfvslyrepggtkvgevlreillteelderte
lllfeasrsklieekiipdlkrdkvvildrfvlstiayqgygkgldvefiknlnefatrg
vkpditllldipvdialrrlkeknrfenkeflekvrkgflelakeeenvvvidasgeeee
vfkeilralsgvlr
Timeline for d5xb2b_: