Lineage for d1c0mb2 (1c0m B:54-216)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606596Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1606866Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 1606867Protein Retroviral integrase, catalytic domain [53108] (3 species)
  7. 1606946Species Rous sarcoma virus RSV [TaxId:11886] [53109] (23 PDB entries)
  8. 1606970Domain d1c0mb2: 1c0m B:54-216 [33641]
    Other proteins in same PDB: d1c0ma1, d1c0mb1, d1c0mc1, d1c0md1

Details for d1c0mb2

PDB Entry: 1c0m (more details), 2.53 Å

PDB Description: crystal structure of rsv two-domain integrase
PDB Compounds: (B:) protein (integrase)

SCOPe Domain Sequences for d1c0mb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0mb2 c.55.3.2 (B:54-216) Retroviral integrase, catalytic domain {Rous sarcoma virus RSV [TaxId: 11886]}
glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiavlg
rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdrirvlaeg
dgfmkriptskqgellakamyalnhkergentktpiqkhwrpt

SCOPe Domain Coordinates for d1c0mb2:

Click to download the PDB-style file with coordinates for d1c0mb2.
(The format of our PDB-style files is described here.)

Timeline for d1c0mb2: