Lineage for d5vtyf_ (5vty F:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266962Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2267146Domain d5vtyf_: 5vty F: [336407]
    Other proteins in same PDB: d5vtya1, d5vtya2, d5vtyc1, d5vtyc2, d5vtye1, d5vtye2
    automated match to d1qfub_
    complexed with bma, gal, man, nag, sia; mutant

Details for d5vtyf_

PDB Entry: 5vty (more details), 2.36 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin g225q/l226a mutant in complex with 3'-sln
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5vtyf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vtyf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf

SCOPe Domain Coordinates for d5vtyf_:

Click to download the PDB-style file with coordinates for d5vtyf_.
(The format of our PDB-style files is described here.)

Timeline for d5vtyf_: