SCOPe 2.03: Domain d1c0ma2: 1c0m A:49-216

Lineage for d1c0ma2 (1c0m A:49-216)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein Retroviral integrase, catalytic domain [53108] (3 species)

7. Species Rous sarcoma virus RSV [TaxId:11886] [53109] (23 PDB entries)

8. Domain d1c0ma2: 1c0m A:49-216 [33640]
   Other proteins in same PDB: d1c0ma1, d1c0mb1, d1c0mc1, d1c0md1

Details for d1c0ma2

PDB Entry: 1c0m, 2.53 Å

PDB Description: crystal structure of rsv two-domain integrase

PDB Compounds: (A:) protein (integrase)

SCOPe Domain Sequences for d1c0ma2:

Sequence; same for both SEQRES and ATOM records:

>d1c0ma2 c.55.3.2 (A:49-216) Retroviral integrase, catalytic domain {Rous sarcoma virus RSV [TaxId: 11886]}
gvnprglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwata
iavlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdrir
vlaegdgfmkriptskqgellakamyalnhkergentktpiqkhwrpt

Timeline for d1c0ma2:

• d1c0ma2 first appeared (with stable ids) in SCOP 1.55
  
• d1c0ma2 appears in SCOPe 2.02
  
• d1c0ma2 appears in SCOPe 2.04
  
• d1c0ma2 appears in the current release, SCOPe 2.08