SCOPe 2.06: Domain d5vu4c1: 5vu4 C:11-325

Lineage for d5vu4c1 (5vu4 C:11-325)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (34 species)
   not a true protein

7. Species Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (11 PDB entries)

8. Domain d5vu4c1: 5vu4 C:11-325 [336395]
   Other proteins in same PDB: d5vu4a2, d5vu4b_, d5vu4c2, d5vu4d_, d5vu4e2, d5vu4f_
   automated match to d4xkga_
   complexed with bma, gal, man, nag, sia; mutant

Details for d5vu4c1

PDB Entry: 5vu4, 2.25 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin g225q/l226a mutant in complex with 6'-sln

PDB Compounds: (C:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5vu4c1:

Sequence; same for both SEQRES and ATOM records:

>d5vu4c1 b.19.1.0 (C:11-325) automated matches {Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
qtslyvqasgrvtvstrrsqqtiipnigsrpwvrqassrisiywtivkpgdvlvinsngn
liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvpe

Timeline for d5vu4c1:

• d5vu4c1 is new in SCOPe 2.06-stable
  
• d5vu4c1 appears in SCOPe 2.07
  
• d5vu4c1 appears in the current release, SCOPe 2.08