Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Aquifex aeolicus [TaxId:224324] [188217] (17 PDB entries) |
Domain d5xb5a_: 5xb5 A: [336393] automated match to d2pbra_ complexed with po4; mutant |
PDB Entry: 5xb5 (more details), 2.23 Å
SCOPe Domain Sequences for d5xb5a_:
Sequence, based on SEQRES records: (download)
>d5xb5a_ c.37.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]} mliafegidgsgkttqakklyeylkqkgyfvslyrepggtkvgevlreillteelderte lllfeasrsklieekiipdlkrdkvvildafvlstiayqgygkgldvefiknlnefatrg vkpditllldipvdialrrlkeknrfenkeflekvrkgflelakeeenvvvidasgeeee vfkeilralsgvl
>d5xb5a_ c.37.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]} mliafegidgsgkttqakklyeylkqkgyfvslyrepggtkvgevlreillteelderte lllfeasrsklieekiipdlkrdkvvildafvlstiayqgygkgldvefiknlnefatrg vkpditllldipvdialrrlkeknrfenkeflekvrkgflelakeeenvvvidasgeeee vfkeilralsvl
Timeline for d5xb5a_: