SCOPe 2.07: Domain d5vtwb_: 5vtw B:

Lineage for d5vtwb_ (5vtw B:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (17 species)
   trimer

7. Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [311114] (14 PDB entries)

8. Domain d5vtwb_: 5vtw B: [336378]
   Other proteins in same PDB: d5vtwa1, d5vtwa2, d5vtwc1, d5vtwc2, d5vtwe1, d5vtwe2
   automated match to d1qfub_
   complexed with bma, gal, man, nag, sia, tam; mutant

Details for d5vtwb_

PDB Entry: 5vtw, 2.35 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin g225m/l226t/s228a mutant in complex with 6'-sln

PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5vtwb_:

Sequence; same for both SEQRES and ATOM records:

>d5vtwb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq

Timeline for d5vtwb_:

• d5vtwb_ first appeared in SCOPe 2.06
  
• d5vtwb_ appears in the current release, SCOPe 2.08