Lineage for d5xaib_ (5xai B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871606Species Aquifex aeolicus [TaxId:224324] [188217] (17 PDB entries)
  8. 2871620Domain d5xaib_: 5xai B: [336376]
    automated match to d4s35b_
    complexed with po4, tmp

Details for d5xaib_

PDB Entry: 5xai (more details), 2 Å

PDB Description: dtmp bound crystal structure of thymidylate kinase (aq_969) from aquifex aeolicus vf5
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d5xaib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xaib_ c.37.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 224324]}
mliafegidgsgkttqakklyeylkqkgyfvslyrepggtkvgevlreillteelderte
lllfeasrsklieekiipdlkrdkvvildrfvlstiayqgygkgldvefiknlnefatrg
vkpditllldipvdialrrlkeknrfenkeflekvrkgflelakeeenvvvidasgeeee
vfkeilralsgv

SCOPe Domain Coordinates for d5xaib_:

Click to download the PDB-style file with coordinates for d5xaib_.
(The format of our PDB-style files is described here.)

Timeline for d5xaib_: