Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Aquifex aeolicus [TaxId:224324] [188217] (17 PDB entries) |
Domain d5xaib_: 5xai B: [336376] automated match to d4s35b_ complexed with po4, tmp |
PDB Entry: 5xai (more details), 2 Å
SCOPe Domain Sequences for d5xaib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xaib_ c.37.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 224324]} mliafegidgsgkttqakklyeylkqkgyfvslyrepggtkvgevlreillteelderte lllfeasrsklieekiipdlkrdkvvildrfvlstiayqgygkgldvefiknlnefatrg vkpditllldipvdialrrlkeknrfenkeflekvrkgflelakeeenvvvidasgeeee vfkeilralsgv
Timeline for d5xaib_: