Lineage for d5vu4f_ (5vu4 F:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 2591606Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [311114] (13 PDB entries)
  8. 2591612Domain d5vu4f_: 5vu4 F: [336373]
    Other proteins in same PDB: d5vu4a1, d5vu4a2, d5vu4c1, d5vu4c2, d5vu4e1, d5vu4e2
    automated match to d1qfub_
    complexed with bma, gal, man, nag, sia; mutant

Details for d5vu4f_

PDB Entry: 5vu4 (more details), 2.25 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin g225q/l226a mutant in complex with 6'-sln
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5vu4f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vu4f_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf

SCOPe Domain Coordinates for d5vu4f_:

Click to download the PDB-style file with coordinates for d5vu4f_.
(The format of our PDB-style files is described here.)

Timeline for d5vu4f_: