SCOPe 2.08: Domain d1vsla_: 1vsl A:

Lineage for d1vsla_ (1vsl A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
   Pfam PF00665

6. Protein Retroviral integrase, catalytic domain [53108] (5 species)

7. Species Rous sarcoma virus RSV [TaxId:11886] [53109] (23 PDB entries)

8. Domain d1vsla_: 1vsl A: [33637]
   complexed with zn; mutant

Details for d1vsla_

PDB Entry: 1vsl, 2.2 Å

PDB Description: asv integrase core domain d64n mutation with zinc cation

PDB Compounds: (A:) protein (integrase)

SCOPe Domain Sequences for d1vsla_:

Sequence; same for both SEQRES and ATOM records:

>d1vsla_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Rous sarcoma virus RSV [TaxId: 11886]}
glgplqiwqtnftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
dgfmkriptskqgellakamyalnhf

Timeline for d1vsla_:

• d1vsla_ first appeared (with stable ids) in SCOP 1.55
  
• d1vsla_ appears in SCOPe 2.07