SCOPe 2.08: Domain d5vtza1: 5vtz A:11-329

Lineage for d5vtza1 (5vtz A:11-329)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (18 PDB entries)

8. Domain d5vtza1: 5vtz A:11-329 [336367]
   Other proteins in same PDB: d5vtza2, d5vtzb_, d5vtzc2, d5vtzd_, d5vtze2, d5vtzf_
   automated match to d4xkga_
   complexed with nag; mutant

Details for d5vtza1

PDB Entry: 5vtz, 2.15 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin g225q/l226a mutant apo form

PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5vtza1:

Sequence; same for both SEQRES and ATOM records:

>d5vtza1 b.19.1.0 (A:11-329) automated matches {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
qtslyvqasgrvtvstrrsqqtiipnigsrpwvrqassrisiywtivkpgdvlvinsngn
liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvpekqtr

Timeline for d5vtza1:

• d5vtza1 first appeared in SCOPe 2.06
  
• d5vtza1 appears in SCOPe 2.07