Lineage for d1vsj__ (1vsj -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25212Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 25292Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein)
  6. 25293Protein Retroviral integrase, catalytic domain [53108] (3 species)
  7. 25321Species Rous sarcoma virus (RSV, avian sarcoma virus) [53109] (21 PDB entries)
  8. 25337Domain d1vsj__: 1vsj - [33636]

Details for d1vsj__

PDB Entry: 1vsj (more details), 2.1 Å

PDB Description: asv integrase core domain with cd(ii) cofactors

SCOP Domain Sequences for d1vsj__:

Sequence, based on SEQRES records: (download)

>d1vsj__ c.55.3.2 (-) Retroviral integrase, catalytic domain {Rous sarcoma virus (RSV, avian sarcoma virus)}
glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
rpkaiktdngsxftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
dgfmkriptskqgellakamyalnhf

Sequence, based on observed residues (ATOM records): (download)

>d1vsj__ c.55.3.2 (-) Retroviral integrase, catalytic domain {Rous sarcoma virus (RSV, avian sarcoma virus)}
glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
rpkaiktdngsftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaegd
gfmkriptskqgellakamyalnhf

SCOP Domain Coordinates for d1vsj__:

Click to download the PDB-style file with coordinates for d1vsj__.
(The format of our PDB-style files is described here.)

Timeline for d1vsj__: