| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) ![]() consists of one domain of this fold |
| Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) |
| Protein Retroviral integrase, catalytic domain [53108] (3 species) |
| Species Rous sarcoma virus RSV [TaxId:11886] [53109] (23 PDB entries) |
| Domain d1vsma_: 1vsm A: [33635] |
PDB Entry: 1vsm (more details), 2.15 Å
SCOPe Domain Sequences for d1vsma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsma_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Rous sarcoma virus RSV [TaxId: 11886]}
glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
dgfmkriptskqgellakamyalnhf
Timeline for d1vsma_: