![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (18 PDB entries) |
![]() | Domain d5vtre1: 5vtr E:11-325 [336346] Other proteins in same PDB: d5vtra2, d5vtrb_, d5vtrc2, d5vtrd_, d5vtre2, d5vtrf_ automated match to d4xkga_ complexed with nag, sia; mutant |
PDB Entry: 5vtr (more details), 2.5 Å
SCOPe Domain Sequences for d5vtre1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vtre1 b.19.1.0 (E:11-325) automated matches {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]} atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe qtslyvqasgrvtvstrrsqqtiipnigsrpwvrlsssrisiywtivkpgdvlvinsngn liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk qntlklatgmrnvpe
Timeline for d5vtre1: