Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (17 species) trimer |
Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [311114] (14 PDB entries) |
Domain d5vtwd_: 5vtw D: [336339] Other proteins in same PDB: d5vtwa1, d5vtwa2, d5vtwc1, d5vtwc2, d5vtwe1, d5vtwe2 automated match to d1qfub_ complexed with bma, gal, man, nag, sia, tam; mutant |
PDB Entry: 5vtw (more details), 2.35 Å
SCOPe Domain Sequences for d5vtwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vtwd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]} glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf
Timeline for d5vtwd_: