Lineage for d5vtwd_ (5vtw D:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266962Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2267139Domain d5vtwd_: 5vtw D: [336339]
    Other proteins in same PDB: d5vtwa1, d5vtwa2, d5vtwc1, d5vtwc2, d5vtwe1, d5vtwe2
    automated match to d1qfub_
    complexed with bma, gal, man, nag, sia, tam; mutant

Details for d5vtwd_

PDB Entry: 5vtw (more details), 2.35 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin g225m/l226t/s228a mutant in complex with 6'-sln
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5vtwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vtwd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf

SCOPe Domain Coordinates for d5vtwd_:

Click to download the PDB-style file with coordinates for d5vtwd_.
(The format of our PDB-style files is described here.)

Timeline for d5vtwd_: