Lineage for d5x5dc_ (5x5d C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2578767Protein Thymidylate synthase [55833] (7 species)
  7. 2578916Species Human (Homo sapiens) [TaxId:9606] [55840] (42 PDB entries)
  8. 2578938Domain d5x5dc_: 5x5d C: [336335]
    automated match to d2aaza_
    complexed with ump

Details for d5x5dc_

PDB Entry: 5x5d (more details), 2 Å

PDB Description: human thymidylate synthase bound with dump
PDB Compounds: (C:) Thymidylate synthase

SCOPe Domain Sequences for d5x5dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x5dc_ d.117.1.1 (C:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphptikmem

SCOPe Domain Coordinates for d5x5dc_:

Click to download the PDB-style file with coordinates for d5x5dc_.
(The format of our PDB-style files is described here.)

Timeline for d5x5dc_: