![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Casein kinase-1, CK1 [56139] (4 species) OPK group; CKI subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [224941] (25 PDB entries) |
![]() | Domain d5w4wa_: 5w4w A: [336324] automated match to d1ckia_ complexed with 9wg, so4 |
PDB Entry: 5w4w (more details), 1.99 Å
SCOPe Domain Sequences for d5w4wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w4wa_ d.144.1.7 (A:) Casein kinase-1, CK1 {Human (Homo sapiens) [TaxId: 9606]} lrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqgg vgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsk nfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasi nthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlck gypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml
Timeline for d5w4wa_: