Lineage for d5x66d_ (5x66 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972208Protein Thymidylate synthase [55833] (7 species)
  7. 2972355Species Human (Homo sapiens) [TaxId:9606] [55840] (47 PDB entries)
  8. 2972370Domain d5x66d_: 5x66 D: [336312]
    automated match to d2aaza_
    complexed with mtx, ump

Details for d5x66d_

PDB Entry: 5x66 (more details), 1.99 Å

PDB Description: human thymidylate synthase in complex with dump and methotrexate
PDB Compounds: (D:) Thymidylate synthase

SCOPe Domain Sequences for d5x66d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x66d_ d.117.1.1 (D:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphptikmemav

SCOPe Domain Coordinates for d5x66d_:

Click to download the PDB-style file with coordinates for d5x66d_.
(The format of our PDB-style files is described here.)

Timeline for d5x66d_: