Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) |
Protein Retroviral integrase, catalytic domain [53108] (4 species) |
Species Rous sarcoma virus RSV [TaxId:11886] [53109] (23 PDB entries) |
Domain d1vsea_: 1vse A: [33631] complexed with epe |
PDB Entry: 1vse (more details), 2.2 Å
SCOPe Domain Sequences for d1vsea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsea_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Rous sarcoma virus RSV [TaxId: 11886]} glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg dgfmkriptskqgellakamyalnhf
Timeline for d1vsea_: