SCOPe 2.05: Domain d1vsea_: 1vse A:

Lineage for d1vsea_ (1vse A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein Retroviral integrase, catalytic domain [53108] (4 species)

7. Species Rous sarcoma virus RSV [TaxId:11886] [53109] (23 PDB entries)

8. Domain d1vsea_: 1vse A: [33631]
   complexed with epe

Details for d1vsea_

PDB Entry: 1vse, 2.2 Å

PDB Description: asv integrase core domain with mg(ii) cofactor and hepes ligand, low mg concentration form

PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d1vsea_:

Sequence; same for both SEQRES and ATOM records:

>d1vsea_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Rous sarcoma virus RSV [TaxId: 11886]}
glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
dgfmkriptskqgellakamyalnhf

Timeline for d1vsea_:

• d1vsea_ first appeared (with stable ids) in SCOP 1.55, called d1vse__
  
• d1vsea_ appears in SCOPe 2.04
  
• d1vsea_ appears in SCOPe 2.06
  
• d1vsea_ appears in the current release, SCOPe 2.08