Lineage for d5vtxd_ (5vtx D:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645407Protein Influenza hemagglutinin (stalk) [58066] (17 species)
    trimer
  7. 2645465Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [311114] (14 PDB entries)
  8. 2645497Domain d5vtxd_: 5vtx D: [336306]
    Other proteins in same PDB: d5vtxa1, d5vtxa2, d5vtxc1, d5vtxc2, d5vtxe1, d5vtxe2
    automated match to d1qfub_
    complexed with bma, man, nag; mutant

Details for d5vtxd_

PDB Entry: 5vtx (more details), 2.65 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin g225m/l226t/s228a mutant apo form
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5vtxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vtxd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf

SCOPe Domain Coordinates for d5vtxd_:

Click to download the PDB-style file with coordinates for d5vtxd_.
(The format of our PDB-style files is described here.)

Timeline for d5vtxd_: