Lineage for d5uiwb1 (5uiw B:10-67)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175338Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2175339Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2175340Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2175656Protein automated matches [190403] (3 species)
    not a true protein
  7. 2175657Species Human (Homo sapiens) [TaxId:9606] [187277] (23 PDB entries)
  8. 2175686Domain d5uiwb1: 5uiw B:10-67 [336302]
    Other proteins in same PDB: d5uiwb2
    automated match to d1eota_
    complexed with ola, olc, zn

Details for d5uiwb1

PDB Entry: 5uiw (more details), 2.2 Å

PDB Description: crystal structure of cc chemokine receptor 5 (ccr5) in complex with high potency hiv entry inhibitor 5p7-ccl5
PDB Compounds: (B:) c-c motif chemokine 5

SCOPe Domain Sequences for d5uiwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uiwb1 d.9.1.1 (B:10-67) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyinslem

SCOPe Domain Coordinates for d5uiwb1:

Click to download the PDB-style file with coordinates for d5uiwb1.
(The format of our PDB-style files is described here.)

Timeline for d5uiwb1: