SCOPe 2.08: Domain d5uiwb1: 5uiw B:10-67

Lineage for d5uiwb1 (5uiw B:10-67)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)

6. Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (2 species)
   has different dimerisation mode

7. Species Human (Homo sapiens) [TaxId:9606] [54133] (19 PDB entries)
   Uniprot P13501 25-91

8. Domain d5uiwb1: 5uiw B:10-67 [336302]
   Other proteins in same PDB: d5uiwb2
   automated match to d1eota_
   complexed with ola, olc, zn

Details for d5uiwb1

PDB Entry: 5uiw, 2.2 Å

PDB Description: crystal structure of cc chemokine receptor 5 (ccr5) in complex with high potency hiv entry inhibitor 5p7-ccl5

PDB Compounds: (B:) c-c motif chemokine 5

SCOPe Domain Sequences for d5uiwb1:

Sequence; same for both SEQRES and ATOM records:

>d5uiwb1 d.9.1.1 (B:10-67) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]}
ccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyinslem

Timeline for d5uiwb1:

• d5uiwb1 first appeared in SCOPe 2.06
  
• d5uiwb1 appears in SCOPe 2.07