SCOPe 2.06: Domain d5vtxa1: 5vtx A:11-329

Lineage for d5vtxa1 (5vtx A:11-329)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (34 species)
   not a true protein

7. Species Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (11 PDB entries)

8. Domain d5vtxa1: 5vtx A:11-329 [336294]
   Other proteins in same PDB: d5vtxa2, d5vtxb_, d5vtxc2, d5vtxd_, d5vtxe2, d5vtxf_
   automated match to d4xkga_
   complexed with bma, man, nag; mutant

Details for d5vtxa1

PDB Entry: 5vtx, 2.65 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin g225m/l226t/s228a mutant apo form

PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5vtxa1:

Sequence; same for both SEQRES and ATOM records:

>d5vtxa1 b.19.1.0 (A:11-329) automated matches {Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
qtslyvqasgrvtvstrrsqqtiipnigsrpwvrmtsarisiywtivkpgdvlvinsngn
liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvpekqtr

Timeline for d5vtxa1:

• d5vtxa1 is new in SCOPe 2.06-stable
  
• d5vtxa1 appears in SCOPe 2.07
  
• d5vtxa1 appears in the current release, SCOPe 2.08