![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein Influenza hemagglutinin (stalk) [58066] (12 species) trimer |
![]() | Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries) |
![]() | Domain d5vtxb_: 5vtx B: [336284] Other proteins in same PDB: d5vtxa1, d5vtxa2, d5vtxc1, d5vtxc2, d5vtxe1, d5vtxe2 automated match to d1qfub_ complexed with bma, man, nag; mutant |
PDB Entry: 5vtx (more details), 2.65 Å
SCOPe Domain Sequences for d5vtxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vtxb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq
Timeline for d5vtxb_: