Lineage for d5vtyd_ (5vty D:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 2591606Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [311114] (13 PDB entries)
  8. 2591620Domain d5vtyd_: 5vty D: [336282]
    Other proteins in same PDB: d5vtya1, d5vtya2, d5vtyc1, d5vtyc2, d5vtye1, d5vtye2
    automated match to d1qfub_
    complexed with bma, gal, man, nag, sia; mutant

Details for d5vtyd_

PDB Entry: 5vty (more details), 2.36 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin g225q/l226a mutant in complex with 3'-sln
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5vtyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vtyd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf

SCOPe Domain Coordinates for d5vtyd_:

Click to download the PDB-style file with coordinates for d5vtyd_.
(The format of our PDB-style files is described here.)

Timeline for d5vtyd_: