Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (22 species) trimer |
Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [311114] (21 PDB entries) |
Domain d5vtyd_: 5vty D: [336282] Other proteins in same PDB: d5vtya1, d5vtya2, d5vtyc1, d5vtyc2, d5vtye1, d5vtye2 automated match to d1qfub_ complexed with nag; mutant |
PDB Entry: 5vty (more details), 2.36 Å
SCOPe Domain Sequences for d5vtyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vtyd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]} glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf
Timeline for d5vtyd_: