Lineage for d5gsqa2 (5gsq A:340-444)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2028025Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 2028028Species Human (Homo sapiens) [TaxId:9606] [88590] (67 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 2028057Domain d5gsqa2: 5gsq A:340-444 [336262]
    Other proteins in same PDB: d5gsqa1, d5gsqb1, d5gsqc1, d5gsqd1
    automated match to d4dz8a2
    complexed with bma, gal, man, nag, sia

Details for d5gsqa2

PDB Entry: 5gsq (more details), 1.85 Å

PDB Description: crystal structure of igg fc with a homogeneous glycoform and antibody- dependent cellular cytotoxicity
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d5gsqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gsqa2 b.1.1.2 (A:340-444) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

SCOPe Domain Coordinates for d5gsqa2:

Click to download the PDB-style file with coordinates for d5gsqa2.
(The format of our PDB-style files is described here.)

Timeline for d5gsqa2: