Lineage for d5w4wb_ (5w4w B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2980262Protein Casein kinase-1, CK1 [56139] (4 species)
    OPK group; CKI subfamily; serine/threonine kinase
  7. 2980268Species Human (Homo sapiens) [TaxId:9606] [224941] (25 PDB entries)
  8. 2980304Domain d5w4wb_: 5w4w B: [336258]
    automated match to d1ckia_
    complexed with 9wg, so4

Details for d5w4wb_

PDB Entry: 5w4w (more details), 1.99 Å

PDB Description: identification and profiling of a selective and brain penetrant radioligand for in vivo target occupancy measurement of casein kinase 1 (ck1) inhibitors
PDB Compounds: (B:) Casein kinase I isoform delta

SCOPe Domain Sequences for d5w4wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w4wb_ d.144.1.7 (B:) Casein kinase-1, CK1 {Human (Homo sapiens) [TaxId: 9606]}
lrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqgg
vgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsk
nfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasi
nthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlck
gypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml

SCOPe Domain Coordinates for d5w4wb_:

Click to download the PDB-style file with coordinates for d5w4wb_.
(The format of our PDB-style files is described here.)

Timeline for d5w4wb_: