SCOPe 2.08: Domain d5w4wb_: 5w4w B:

Lineage for d5w4wb_ (5w4w B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Casein kinase-1, CK1 [56139] (4 species)
   OPK group; CKI subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [224941] (25 PDB entries)

8. Domain d5w4wb_: 5w4w B: [336258]
   automated match to d1ckia_
   complexed with 9wg, so4

Details for d5w4wb_

PDB Entry: 5w4w, 1.99 Å

PDB Description: identification and profiling of a selective and brain penetrant radioligand for in vivo target occupancy measurement of casein kinase 1 (ck1) inhibitors

PDB Compounds: (B:) Casein kinase I isoform delta

SCOPe Domain Sequences for d5w4wb_:

Sequence; same for both SEQRES and ATOM records:

>d5w4wb_ d.144.1.7 (B:) Casein kinase-1, CK1 {Human (Homo sapiens) [TaxId: 9606]}
lrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqgg
vgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsk
nfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasi
nthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlck
gypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml

Timeline for d5w4wb_:

• d5w4wb_ first appeared in SCOPe 2.06
  
• d5w4wb_ appears in SCOPe 2.07