Lineage for d5vtuf_ (5vtu F:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266962Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2267192Domain d5vtuf_: 5vtu F: [336257]
    Other proteins in same PDB: d5vtua1, d5vtua2, d5vtuc1, d5vtuc2, d5vtue1, d5vtue2
    automated match to d1qfub_
    complexed with bma, man, nag; mutant

Details for d5vtuf_

PDB Entry: 5vtu (more details), 2.45 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin g225l/l226s mutant apo form
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5vtuf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vtuf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf

SCOPe Domain Coordinates for d5vtuf_:

Click to download the PDB-style file with coordinates for d5vtuf_.
(The format of our PDB-style files is described here.)

Timeline for d5vtuf_: